General Information

  • ID:  hor006620
  • Uniprot ID:  P0C0P7
  • Protein name:  Neuropeptide S precursor
  • Gene name:  Nps
  • Organism:  Rattus norvegicus (Rat)
  • Family:  NA
  • Source:  animal
  • Expression:  Expressed in mammary, salivary and thyroid gland. Expressed in the brain, in a cluster of cells located between the locus coeruleus (LC) and Barrington's nucleus, as well as in few cells of the dorsomedial hypothalamic nucleus and the amygdala.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0008542 visual learning; GO:0010841 positive regulation of circadian sleep/wake cycle, wakefulness; GO:0032230 positive regulation of synaptic transmission, GABAergic; GO:0035249 synaptic transmission, glutamatergic; GO:0045760 positive regulation of action potential; GO:0051968 positive regulation of synaptic transmission, glutamatergic
  • GO CC:  GO:0005576 extracellular region; GO:0045202 synapse

Sequence Information

  • Sequence:  YPVLSSKVPGKPDYFLILLSTCPARLEGSDGLAFLKPILEKTSMKRSFRNGVGSGVKKTSFRRAKQ
  • Length:  66
  • Propeptide:  MIGSLKLNLILALSLSVVHVIWSYPVLSSKVPGKPDYFLILLSTCPARLEGSDGLAFLKPILEKTSMKRSFRNGVGSGVKKTSFRRAKQ
  • Signal peptide:  MIGSLKLNLILALSLSVVHVIWS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May play an important anorexigenic role. Modulates arousal and anxiety as well as increases locomotor activity. Binds to its receptor NPSR1 with nanomolar affinity to increase intracellular calcium concentrations.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Npsr1
  • Target Unid:  P0C0L6
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P0C0P7-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006620_AF2.pdbhor006620_ESM.pdb

Physical Information

Mass: 843311 Formula: C329H539N91O90S2
Absent amino acids: HW Common amino acids: KLS
pI: 11.03 Basic residues: 13
Polar residues: 21 Hydrophobic residues: 21
Hydrophobicity: -28.79 Boman Index: -10545
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 81.21
Instability Index: 4659.24 Extinction Coefficient cystines: 2980
Absorbance 280nm: 45.85

Literature

  • PubMed ID:  15312648
  • Title:  Neuropeptide S: a neuropeptide promoting arousal and anxiolytic-like effects.
  • PubMed ID:  15919054
  • Title:  Peptide S is a novel potent inhibitor of voluntary and fast-induced food intake in rats.